Structure of PDB 3dll Chain K

Receptor sequence

>3dllK (length=113) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

HGKAGRKLNRNSSARVALARAQATALLREGRIQTTLTKAKELRPFVEQLI
TTAKGGDLHSRRLVAQDIHDKDVVRKVMDEVAPKYAERPGGYTRILRVGT
RRGDGVTMALIEL

3D structure

PDB

3dll The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	H3 K5 A6 G7 R8 L10 R12 S14 R22 E31 I34 T36 T39 K40 K42 Q50 T53 L60 H61 R63 R64 Q68 H71 K73 R90 P91 G92 G93 T95 R96 R99 R103 G105 D106 G107 V108	H1 K3 A4 G5 R6 L8 R10 S12 R20 E29 I32 T34 T37 K38 K40 Q48 T51 L58 H59 R61 R62 Q66 H69 K71 R88 P89 G90 G91 T93 R94 R97 R101 G103 D104 G105 V106

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3dll, PDBe:3dll, PDBj:3dll
PDBsum	3dll
PubMed	18757750
UniProt	Q9RSJ5\|RL17_DEIRA Large ribosomal subunit protein bL17 (Gene Name=rplQ)