Structure of PDB 3a0h Chain K

Receptor sequence
>3a0hK (length=36) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF
3D structure
PDB3a0h Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
ChainK
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide K P20 L21 D23 V24 L35 V38 V39 P11 L12 D14 V15 L26 V29 V30
BS02 CLA K F37 Q40 F28 Q31
BS03 CLA K P29 V30 F33 P20 V21 F24
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3a0h, PDBe:3a0h, PDBj:3a0h
PDBsum3a0h
PubMed19433803
UniProtP19054|PSBK_THEVL Photosystem II reaction center protein K (Fragment) (Gene Name=psbK)

[Back to BioLiP]