Structure of PDB 2zjp Chain K

Receptor sequence

>2zjpK (length=113) Species: 1299 (Deinococcus radiodurans)

HGKAGRKLNRNSSARVALARAQATALLREGRIQTTLTKAKELRPFVEQLI
TTAKGGDLHSRRLVAQDIHDKDVVRKVMDEVAPKYAERPGGYTRILRVGT
RRGDGVTMALIEL

3D structure

• PDB: 2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
• Chain: K
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	H3 K5 A6 G7 L10 R12 S14 A19 L20 R22 I34 Q35 T36 T37 K40 K42 P46 E49 Q50 T53 L60 H61 R63 R64 Q68 H71 K73 P91 G92 G93 T95 R96 R99 R103 G105 D106 V108	H1 K3 A4 G5 L8 R10 S12 A17 L18 R20 I32 Q33 T34 T35 K38 K40 P44 E47 Q48 T51 L58 H59 R61 R62 Q66 H69 K71 P89 G90 G91 T93 R94 R97 R101 G103 D104 V106

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2zjp, PDBe:2zjp, PDBj:2zjp
• PDBsum: 2zjp
• PubMed: 18406324
• UniProt: Q9RSJ5|RL17_DEIRA Large ribosomal subunit protein bL17 (Gene Name=rplQ)