Structure of PDB 2ykr Chain K

Receptor sequence

>2ykrK (length=117) Species: 668369 (Escherichia coli DH5[alpha]) [Search protein sequence]

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV

3D structure

PDB

2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.

Chain

Resolution

9.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	R12 H21 H23 N27 N28 I30 T32 T34 G38 N39 A40 L41 G42 W43 T45 G47 G48 R52 G53 S54 R55 K56 S57 R68 A72 Y76 K86 P114 I115 P116 H117 N118 G119 C120 R121 P122 P123 K124 K125 R126 R127 V128	R1 H10 H12 N16 N17 I19 T21 T23 G27 N28 A29 L30 G31 W32 T34 G36 G37 R41 G42 S43 R44 K45 S46 R57 A61 Y65 K75 P103 I104 P105 H106 N107 G108 C109 R110 P111 P112 K113 K114 R115 R116 V117

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
PDBsum	2ykr
PubMed	21788480
UniProt	P0A7R9\|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)