Structure of PDB 2wwa Chain K

Receptor sequence
>2wwaK (length=83) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
LDSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVD
VLKVNTLVRPNGTKKAYVRLTADYDALDIANRI
3D structure
PDB2wwa Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
ChainK
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K K61 K89 K5 K33
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wwa, PDBe:2wwa, PDBj:2wwa
PDBsum2wwa
PubMed19933108
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]