Structure of PDB 2vs8 Chain K

Receptor sequence

>2vs8K (length=177) [Search protein sequence]

NVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPL
MQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMRE
QIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDD
HRHGVYVLNISLRDRIKFVHTILSSHL

3D structure

PDB

2vs8 Crystal Structure of I-Dmoi in Complex with its Target DNA Provides New Insights Into Meganuclease Engineering.

Chain

Resolution

2.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	K	K86 Y89 N93 R97	K81 Y84 N88 R92
BS02	dna	K	D21 T41 Q42 K43 T76 R77 R124 T150 H152 D154 R157 S166 L167	D16 T36 Q37 K38 T71 R72 R119 T145 H147 D149 R152 S161 L162
BS03	dna	K	G20 D21 G22 Y25 Y29 R33 R37 R77 E117	G15 D16 G17 Y20 Y24 R28 R32 R72 E112
BS04	dna	K	N32 R33 S34 E35 Y36 R37 S67 K68 Q70 R81 S83 S84 K85 E117 W128 N129 K130 D155 H158 V160	N27 R28 S29 E30 Y31 R32 S62 K63 Q65 R76 S78 S79 K80 E112 W123 N124 K125 D150 H153 V155
BS05	dna	K	A116 D119 K120 R126 W128	A111 D114 K115 R121 W123
BS06	MN	K	D21 A116	D16 A111
BS07	MN	K	G20 E117	G15 E112

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing
GO:0016539	intein-mediated protein splicing

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2vs8, PDBe:2vs8, PDBj:2vs8
PDBsum	2vs8
PubMed	18974222
UniProt	P21505\|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]