Structure of PDB 2nuu Chain K

Receptor sequence
>2nuuK (length=112) Species: 562 (Escherichia coli) [Search protein sequence]
MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAE
YSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVI
RIRTGEADEAAL
3D structure
PDB2nuu The crystal structure of the Escherichia coli AmtB-GlnK complex reveals how GlnK regulates the ammonia channel
ChainK
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP K I7 G35 F36 R38 Q39 K58 G87 K90 I7 G35 F36 R38 Q39 K58 G87 K90
BS02 ADP K G27 L28 T29 V63 A64 R101 R103 G27 L28 T29 V63 A64 R101 R103
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
GO:0042802 identical protein binding
Biological Process
GO:0006808 regulation of nitrogen utilization
GO:0045848 positive regulation of nitrogen utilization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2nuu, PDBe:2nuu, PDBj:2nuu
PDBsum2nuu
PubMed17220269
UniProtP0AC55|GLNK_ECOLI Nitrogen regulatory protein GlnK (Gene Name=glnK)

[Back to BioLiP]