Structure of PDB 2fkw Chain K

Receptor sequence
>2fkwK (length=53) Species: 1074 (Rhodoblastus acidophilus) [Search protein sequence]
MNQGKIWTVVNPAIGIPALLGSVTVIAILVHLAILSHTTWFPAYWQGGVK
KAA
3D structure
PDB2fkw Room to Move: Crystallizing Membrane Proteins in Swollen Lipidic Mesophases
ChainK
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL K Y44 W45 Y44 W45
BS02 BCL K L20 T24 H31 W40 F41 Y44 W45 L20 T24 H31 W40 F41 Y44 W45
BS03 BCL K M1 N2 Q3 M1 N2 Q3
BS04 BCL K V23 A27 V30 H31 I34 W40 V23 A27 V30 H31 I34 W40
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2fkw, PDBe:2fkw, PDBj:2fkw
PDBsum2fkw
PubMed16490208
UniProtP26789|LHA4_RHOAC Light-harvesting protein B-800/850 alpha chain

[Back to BioLiP]