Structure of PDB 2axt Chain K

Receptor sequence
>2axtK (length=37) Species: 146786 (Thermosynechococcus vestitus) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB2axt Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
ChainK
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K P29 V30 L33 P20 V21 L24
BS02 CLA K W39 Q40 W30 Q31
BS03 CA K D19 D23 D10 D14
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2axt, PDBe:2axt, PDBj:2axt
PDBsum2axt
PubMed16355230
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]