Structure of PDB 1y69 Chain K

Receptor sequence

>1y69K (length=136) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]

KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVM
SRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMF
EVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA

3D structure

PDB

1y69 X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit

Chain

Resolution

3.33 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	R11 K12 Q13 F14 R15 R17 M18 D21 K23 N46 A50 I53 R60 R61 Y66 I67 R68 F70 K78 E81 R83 M84 G85 K86 G87 K88 H124 K125 E140 A141	R6 K7 Q8 F9 R10 R12 M13 D16 K18 N41 A45 I48 R55 R56 Y61 I62 R63 F65 K73 E76 R78 M79 G80 K81 G82 K83 H119 K120 E135 A136	PDBbind-CN: Kd=0.52uM
BS02	rna	K	T19 D21 E39 P40 K99	T14 D16 E34 P35 K94	PDBbind-CN: Kd=0.52uM

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1y69, PDBe:1y69, PDBj:1y69
PDBsum	1y69
PubMed	15616575
UniProt	Q9RXJ5\|RL16_DEIRA Large ribosomal subunit protein uL16 (Gene Name=rplP)