Structure of PDB 1qvg Chain K

Receptor sequence

>1qvgK (length=145) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSG
FKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADY
VKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ

3D structure

PDB

1qvg Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	T1 K3 K4 K5 R6 R8 G9 R11 T12 H13 G14 G15 G16 H18 K19 N20 R21 R22 G23 A24 G25 H26 R27 G28 G29 R30 G31 D32 R35 K37 H38 E39 F40 H41 L46 G47 K48 G50 F51 K52 R53 P54 K56 V57 D65 R67 D70 E71 K107 L109 G110 A111 G112 Q113 R115 S126	T1 K3 K4 K5 R6 R8 G9 R11 T12 H13 G14 G15 G16 H18 K19 N20 R21 R22 G23 A24 G25 H26 R27 G28 G29 R30 G31 D32 R35 K37 H38 E39 F40 H41 L46 G47 K48 G50 F51 K52 R53 P54 K56 V57 D65 R67 D70 E71 K102 L104 G105 A106 G107 Q108 R110 S121

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1qvg, PDBe:1qvg, PDBj:1qvg
PDBsum	1qvg
PubMed	14561884
UniProt	P12737\|RL15_HALMA Large ribosomal subunit protein uL15 (Gene Name=rpl15)