Structure of PDB 1ngk Chain K

Receptor sequence
>1ngkK (length=127) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
PKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMF
LEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDS
ETLDDEHRRELLDYLEMAAHSLVNSPF
3D structure
PDB1ngk A TyrCD1/TrpG8 hydrogen bond network and a TyrB10-TyrCD1 covalent link shape the heme distal site of Mycobacterium tuberculosis hemoglobin O
ChainK
Resolution2.11 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CYN K Y36 W88 Y35 W87
BS02 HEM K Y36 A44 R47 F51 Y62 R66 R74 H75 F78 I80 W88 Y115 A119 A120 L123 Y35 A43 R46 F50 Y61 R65 R73 H74 F77 I79 W87 Y114 A118 A119 L122
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005515 protein binding
GO:0008941 nitric oxide dioxygenase NAD(P)H activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0051410 detoxification of nitrogen compound
Cellular Component
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ngk, PDBe:1ngk, PDBj:1ngk
PDBsum1ngk
PubMed12719529
UniProtP9WN23|TRHBO_MYCTU Group 2 truncated hemoglobin GlbO (Gene Name=glbO)

[Back to BioLiP]