Structure of PDB 1loj Chain K

Receptor sequence

>1lojK (length=72) Species: 187420 (Methanothermobacter thermautotrophicus str. Delta H)

NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELED
GEVTRRLGTVLIRGDNIVYISR

3D structure

• PDB: 1loj The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
• Chain: K
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	U	K	H46 N48 R72 D74	H37 N39 R63 D65

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome

Cellular Component

• GO:0120114 Sm-like protein family complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1loj, PDBe:1loj, PDBj:1loj
• PDBsum: 1loj
• PubMed: 12649441
• UniProt: O26745|RUXX_METTH Putative snRNP Sm-like protein (Gene Name=MTH_649)