Structure of PDB 1is7 Chain K

Receptor sequence
>1is7K (length=84) Species: 10116 (Rattus norvegicus) [Search protein sequence]
MPYLLISTQIRMEVGPTMVGDEHSDPELMQQLGASKRRVLGNNFYEYYVN
DPPRIVLDKLECRGFRVLSMTGVGQTLVWCLHKE
3D structure
PDB1is7 Crystal structure of the stimulatory complex of GTP cyclohydrolase I and its feedback regulatory protein GFRP.
ChainK
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PHE K I10 R11 Q75 L77 I10 R11 Q75 L77
BS02 PHE K V73 G74 Q75 T76 V73 G74 Q75 T76
Gene Ontology
Molecular Function
GO:0004857 enzyme inhibitor activity
GO:0005515 protein binding
GO:0016597 amino acid binding
GO:0019899 enzyme binding
GO:0030742 GTP-dependent protein binding
GO:0042802 identical protein binding
GO:0044549 GTP cyclohydrolase binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0009890 negative regulation of biosynthetic process
GO:0045428 regulation of nitric oxide biosynthetic process
GO:0065003 protein-containing complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0030425 dendrite
GO:0031965 nuclear membrane
GO:0032991 protein-containing complex
GO:0042470 melanosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1is7, PDBe:1is7, PDBj:1is7
PDBsum1is7
PubMed11818540
UniProtP70552|GFRP_RAT GTP cyclohydrolase 1 feedback regulatory protein (Gene Name=Gchfr)

[Back to BioLiP]