Structure of PDB 1hlt Chain K

Receptor sequence

>1hltK (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTG
QPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDS
GGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID
Q

3D structure

• PDB: 1hlt Structure of a nonadecapeptide of the fifth EGF domain of thrombomodulin complexed with thrombin.
• Chain: K
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	K	E23 I24 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 G136 R137 N159 M201 K202 R206 W207	E8 I9 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 G136 R137 N159 M206 K207 R213 W214
BS02	peptide	K	Q38 R67 Y76 R77A I82	Q24 R62 Y71 R73 I78
BS03	0G6	K	H57 Y60A W60D L99 I174 D189 A190 C191 S195 S214 W215 G216	H43 Y47 W50 L96 I174 D194 A195 C196 S200 S221 W222 G223

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1hlt, PDBe:1hlt, PDBj:1hlt
• PDBsum: 1hlt
• PubMed: 7947765
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)