Structure of PDB 1de7 Chain K

Receptor sequence

>1de7K (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
G

3D structure

• PDB: 1de7 Interaction of the factor XIII activation peptide with alpha -thrombin. Crystal structure of its enzyme-substrate analog complex.
• Chain: K
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	K	E23 I24 G25 M26 P28 W29 D116 H119 P120 V121 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E8 I9 G10 M11 P13 W14 D113 H116 P117 V118 C119 Y134 K135 R137 N157 M204 K205 N210 R211 W212
BS02	peptide	K	H57 Y60A W60D R97 E97A R173 I174 D189 A190 C191 E192 S195 S214 W215 G216 E217	H43 Y47 W50 R93 E94 R171 I172 D192 A193 C194 E195 S198 S219 W220 G221 E222

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1de7, PDBe:1de7, PDBj:1de7
• PDBsum: 1de7
• PubMed: 10956659
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)