Structure of PDB 8rdw Chain JY

Receptor sequence
>8rdwJY (length=100) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]
QRIRIRLKSFDHRLIDQSAQEIVDTAKRTGAQVCGPVPLPTRIERFNVLT
SPHVNKDARDQYEIRTHKRMVDIVQPTDKTVDALMKLDLAAGVDVQIALG
3D structure
PDB8rdw A new family of bacterial ribosome hibernation factors
ChainJY
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna JY R7 H15 G38 V40 P41 L42 P43 T44 R45 E47 N50 T53 S54 P55 H56 N58 K59 A61 H70 K71 R72 M73 D75 R4 H12 G35 V37 P38 L39 P40 T41 R42 E44 N47 T50 S51 P52 H53 N55 K56 A58 H67 K68 R69 M70 D72
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rdw, PDBe:8rdw, PDBj:8rdw
PDBsum8rdw
PubMed38355796
UniProtA0A0M4TE68

[Back to BioLiP]