Structure of PDB 8pfr Chain JW

Receptor sequence

>8pfrJW (length=197) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

VEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKL
KYHDFLRKATAFNKTRGPFHFRAPSRIFYKALRGMVSHKTARGKAALERL
KVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDV
VAKLEAKRKVSSAEYYAKKRAFTKKVASANATAAESDVAKQLAALGY

3D structure

PDB

8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	JW	E4 P5 V6 G17 R18 S21 K25 S44 F48 R49 L52 R59 K60 A61 T62 F64 N65 K66 R68 P70 F71 H72 F73 R74 K82 A83 R85 G86 M87 H90 A93 R94 R101 F105 I108 P110 K114 K115 K116 R128 L129 K130 R133 K134 G146 K148 Y149 L156 K159 S164 Y167 Y168 K171	E2 P3 V4 G15 R16 S19 K23 S42 F46 R47 L50 R57 K58 A59 T60 F62 N63 K64 R66 P68 F69 H70 F71 R72 K80 A81 R83 G84 M85 H88 A91 R92 R99 F103 I106 P108 K112 K113 K114 R126 L127 K128 R131 K132 G144 K146 Y147 L154 K157 S162 Y165 Y166 K169

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum	8pfr
PubMed
UniProt	P26784\|RL16A_YEAST Large ribosomal subunit protein uL13A (Gene Name=RPL16A)

[Back to BioLiP]