Structure of PDB 8pfr Chain JT

Receptor sequence

>8pfrJT (length=189) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL
DLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRR
QNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPA
TDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREK

3D structure

PDB

8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	JT	I3 K5 L7 L10 K11 N12 H13 F14 R15 K16 H17 W18 Q28 K31 K32 R35 R36 R39 R42 R55 V58 R59 P61 T62 Y65 N66 K68 R70 R73 R91 D98 H99 R100 R101 R104 R168 R171 R174 S175 K178 F179 R180 R183 K185 R186	I2 K4 L6 L9 K10 N11 H12 F13 R14 K15 H16 W17 Q27 K30 K31 R34 R35 R38 R41 R54 V57 R58 P60 T61 Y64 N65 K67 R69 R72 R90 D97 H98 R99 R100 R103 R167 R170 R173 S174 K177 F178 R179 R182 K184 R185
BS02	rna	JT	F26 D27	F25 D26

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum	8pfr
PubMed
UniProt	Q12690\|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]