Structure of PDB 6zqc Chain JM

Receptor sequence
>6zqcJM (length=135) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SKFQEIETNLKKLPKLETGFDALANKKKKKNVLPSNDWFTLPKPDDNMRR
EVQRDLLLIKHRAALDPKRHYKKQRWEVPERFAIGTIIESTILETLMGDE
ASNKYFKRKYNEIQEKSTSGRKAHYKKMKEMRKKR
3D structure
PDB6zqc 90 S pre-ribosome transformation into the primordial 40 S subunit.
ChainJM
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna JM Q195 R202 K203 K207 Q114 R121 K122 K126
BS02 rna JM P132 K133 H135 Y136 K137 K138 R140 R189 K190 K203 Y206 K210 R213 P67 K68 H70 Y71 K72 K73 R75 R108 K109 K122 Y125 K129 R132
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zqc, PDBe:6zqc, PDBj:6zqc
PDBsum6zqc
PubMed32943521
UniProtQ12035|FCF2_YEAST rRNA-processing protein FCF2 (Gene Name=FCF2)

[Back to BioLiP]