Structure of PDB 7ajt Chain JK

Receptor sequence
>7ajtJK (length=42) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SKGRKLNYSVQDPIANYEAPITSGYKWSDDQIDEFFAGLLGQ
3D structure
PDB7ajt Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
ChainJK
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna JK S459 K460 G461 R462 K463 S1 K2 G3 R4 K5
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0032040 small-subunit processome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ajt, PDBe:7ajt, PDBj:7ajt
PDBsum7ajt
PubMed33326748
UniProtQ06631|BFR2_YEAST Protein BFR2 (Gene Name=BFR2)

[Back to BioLiP]