Structure of PDB 5mre Chain JJ

Receptor sequence

>5mreJJ (length=186) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

STRPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRT
GYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWD
TNPEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSN
IDELYSLRNDDKAQTSAVGQKVLELLDSPDFKKHLE

3D structure

PDB

5mre The structure of the yeast mitochondrial ribosome.

Chain

Resolution

3.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	JJ	K33 G39 Q46 R48 N52 T74 K77 P78 P80 T81 R82 R83 R85 T87 I89 K90 S91 P92 F93 V94 H95 A96 K97 S98 K99 N101 H107 K108 R109 L110 R112 K139	K18 G24 Q31 R33 N37 T59 K62 P63 P65 T66 R67 R68 R70 T72 I74 K75 S76 P77 F78 V79 H80 A81 K82 S83 K84 N86 H92 K93 R94 L95 R97 K124

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mre, PDBe:5mre, PDBj:5mre
PDBsum	5mre
PubMed	28154081
UniProt	Q03201\|RT10_YEAST Small ribosomal subunit protein uS10m (Gene Name=RSM10)

[Back to BioLiP]