Structure of PDB 5e7k Chain J8

Receptor sequence

>5e7kJ8 (length=94) Species: 300852 (Thermus thermophilus HB8)

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL

3D structure

• PDB: 5e7k Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
• Chain: J8
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J8	K23 V30	K22 V29
BS02	rna	J8	S2 K3 K10 I13 V14 A15 N16 R20 R21 A24 K25 G28 G29 V30 G31 K32 K33 T34 T35 I37 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 R61 S65 K69 K88	S1 K2 K9 I12 V13 A14 N15 R19 R20 A23 K24 G27 G28 V29 G30 K31 K32 T33 T34 I36 K38 R39 R40 Q41 Y42 P43 N44 Q46 R49 R51 R60 S64 K68 K87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5e7k, PDBe:5e7k, PDBj:5e7k
• PDBsum: 5e7k
• PubMed: 26791911
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)