Structure of PDB 4wr6 Chain J8

Receptor sequence
>4wr6J8 (length=93) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKEL
3D structure
PDB4wr6 Structural insights into the translational infidelity mechanism.
ChainJ8
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J8 S2 K3 K10 I13 V14 A15 N16 R20 R21 K25 R26 G29 V30 K33 T34 T35 I37 K39 R40 R41 Q42 Y43 P44 N45 Q47 R52 R61 S65 H66 K69 K88 S1 K2 K9 I12 V13 A14 N15 R19 R20 K24 R25 G28 V29 K32 T33 T34 I36 K38 R39 R40 Q41 Y42 P43 N44 Q46 R51 R60 S64 H65 K68 K87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wr6, PDBe:4wr6, PDBj:4wr6
PDBsum4wr6
PubMed26037619
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]