Structure of PDB 7y5e Chain J2

Receptor sequence
>7y5eJ2 (length=38) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
NNFLKYLSVMPVAGTIFMIFTAGLVIEVNRFYPDALFF
3D structure
PDB7y5e In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
ChainJ2
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J2 M12 P13 T17 M20 M10 P11 T15 M18
BS02 CLA J2 V30 D36 A37 V28 D34 A35
BS03 CLA J2 F19 T23 V27 F17 T21 V25
BS04 CLA J2 F22 G25 E29 F20 G23 E27
BS05 3XQ J2 Y34 A37 L38 F39 F40 Y32 A35 L36 F37 F38
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y5e, PDBe:7y5e, PDBj:7y5e
PDBsum7y5e
PubMed36922595
UniProtW0RYG9

[Back to BioLiP]