Structure of PDB 5zf0 Chain J2

Receptor sequence
>5zf0J2 (length=41) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHPL
3D structure
PDB5zf0 X-ray structure of an asymmetrical trimeric ferredoxin-photosystem I complex
ChainJ2
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J2 A11 P12 A16 M19 T20 A11 P12 A16 M19 T20
BS02 CLA J2 F29 D35 L36 F29 D35 L36
BS03 CLA J2 W18 M19 T22 W18 M19 T22
BS04 CLA J2 I21 G24 I25 E28 R31 F32 I21 G24 I25 E28 R31 F32
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zf0, PDBe:5zf0, PDBj:5zf0
PDBsum5zf0
PubMed29610537
UniProtP0A429|PSAJ_THEVB Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]