Structure of PDB 7r81 Chain J1

Receptor sequence

>7r81J1 (length=236) Species: 5141 (Neurospora crassa) [Search protein sequence]

NPLIEKRPRNFGIGQAIQPKRNLSRMVKWPEYVRLQRQKKILNMRLKVPP
ALAQFQQVLDKNTAAQAFKLLNKYRPETKTEKKERLLQEATAIKEGKKKE
DVSKKPYVVKYGLNHVVGLIENKKASLVLIPNDVDPIELVVFLPALCRKM
GIPYAIIKGKARLGTVVHKKTAAVLALTEVRAEDKNELAKLVSAIKEGYL
EKNEQARRQWGGGIMGVKSQMKIAKRKKALENAIKV

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J1	I30 E31 K32 R33 R35 N36 F37 G38 I39 G40 Q41 I43 Q44 P45 R47 L49 S50 R51 M52 K54 P56 Y58 R63 R71 K108 R111 E126 S129 K131 P132 Y137 G138 L139 H141 G144 L145 N148 D161 P162 K186 A187 K195 K196 A198 A199 G242 V243 K244 S245 K251	I4 E5 K6 R7 R9 N10 F11 G12 I13 G14 Q15 I17 Q18 P19 R21 L23 S24 R25 M26 K28 P30 Y32 R37 R45 K82 R85 E100 S103 K105 P106 Y111 G112 L113 H115 G118 L119 N122 D135 P136 K160 A161 K169 K170 A172 A173 G216 V217 K218 S219 K225
BS02	rna	J1	Y58 V59 Q62 R63 K66 K87 K184 R188	Y32 V33 Q36 R37 K40 K61 K158 R162

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum	7r81
PubMed	34815343
UniProt	Q6MFL6

[Back to BioLiP]