Structure of PDB 7fix Chain J1

Receptor sequence
>7fixJ1 (length=41) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHPL
3D structure
PDB7fix Structure of cyanobacterial photosystem I complexed with ferredoxin at 1.97 angstrom resolution.
ChainJ1
Resolution1.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J1 P12 M19 T20 P12 M19 T20
BS02 CLA J1 N30 D35 L36 L37 N30 D35 L36 L37
BS03 CLA J1 W18 M19 T22 W18 M19 T22
BS04 CLA J1 E28 R31 E28 R31
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fix, PDBe:7fix, PDBj:7fix
PDBsum7fix
PubMed36097054
UniProtP0A429|PSAJ_THEVB Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]