Structure of PDB 9ax7 Chain J

Receptor sequence
>9ax7J (length=98) Species: 562 (Escherichia coli) [Search protein sequence]
RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIS
PHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL
3D structure
PDB9ax7 Structural analysis of noncanonical translation initiation complexes.
ChainJ
Resolution2.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J R7 R9 K11 H15 R37 G38 P39 I40 P41 L42 P43 R45 I53 S54 P55 H56 V57 N58 K59 A61 R62 Q64 R68 H70 R72 L73 D75 R3 R5 K7 H11 R33 G34 P35 I36 P37 L38 P39 R41 I49 S50 P51 H52 V53 N54 K55 A57 R58 Q60 R64 H66 R68 L69 D71
External links