Structure of PDB 8xmc Chain J |
>8xmcJ (length=62) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
MIIPVRCFTCGKVIGNKWDQYLDLLQLDYTEGDALDALQLVRYCCRRMLM THVDLIEKLLNY |
|
PDB | 8xmc Transcription of the Plant RNA polymerase IV is prone to backtracking |
Chain | J |
Resolution | 3.1 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C44 C45 |
C44 C45 |
|
|
|
|