Structure of PDB 8x15 Chain J

Receptor sequence
>8x15J (length=158) Species: 9606 (Homo sapiens) [Search protein sequence]
RQSTAEHTRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITEELN
LRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPRCSRTFITFSDDA
TFEEWFPQGRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREA
YKKYITAH
3D structure
PDB8x15 Structure of nucleosome-bound SRCAP-C in the apo state
ChainJ
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna J K159 P161 K26 P28
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042393 histone binding
GO:0140713 histone chaperone activity
GO:0140849 ATP-dependent H2AZ histone chaperone activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0035019 somatic stem cell population maintenance
GO:0042981 regulation of apoptotic process
GO:0045815 transcription initiation-coupled chromatin remodeling
GO:0045893 positive regulation of DNA-templated transcription
GO:0051726 regulation of cell cycle
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000779 regulation of double-strand break repair
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016607 nuclear speck
GO:0032991 protein-containing complex
GO:0035267 NuA4 histone acetyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x15, PDBe:8x15, PDBj:8x15
PDBsum8x15
PubMed38331872
UniProtQ15906|VPS72_HUMAN Vacuolar protein sorting-associated protein 72 homolog (Gene Name=VPS72)

[Back to BioLiP]