Structure of PDB 8wgh Chain J

Receptor sequence
>8wghJ (length=40) Species: 141305 (Fittonia albivenis) [Search protein sequence]
MRDLKTYLSVAPVLSTLWFGALAGLLIEINRFFPDALTFP
3D structure
PDB8wgh Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI
ChainJ
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J S15 W18 S15 W18
BS02 CLA J D35 A36 D35 A36
BS03 CLA J W18 F19 L22 W18 F19 L22
BS04 CLA J P12 G20 P12 G20
BS05 CLA J E28 R31 E28 R31
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wgh, PDBe:8wgh, PDBj:8wgh
PDBsum8wgh
PubMed39060282
UniProtQ3C1K9|PSAJ_NICSY Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]