Structure of PDB 8upp Chain J

Receptor sequence

>8uppJ (length=327) Species: 197 (Campylobacter jejuni)

ITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDNGVNVTIGLREGS
VSAVKAKNAGFEVMSVSEASKIADVIMILAPDEIQADIFNVEIKPNLSEG
KAIAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLI
AIHQDESKNAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCG
GLSALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLIYQGGIADMRYSI
SNTAEYGDYITGPKIITEETKKAMKGVLKDIQNGVFAKDFILERRAGFAR
MHAERKNMNDSLIEKTGRNLRAMMPWI

3D structure

• PDB: 8upp Mapping of the Reaction Trajectory catalyzed by Class I Ketol-Acid Reductoisomerase
• Chain: J
• Resolution: 1.78 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.86: ketol-acid reductoisomerase (NADP(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	X9W	J	E232 S253 A256	E230 S251 A254
BS02	NDP	J	S251 S253	S249 S251
BS03	MG	J	D192 E196	D190 E194
BS04	X9W	J	A133 P134 D192 E196	A131 P132 D190 E194
BS05	NDP	J	G25 F26 G27 S28 Q29 L48 S54 V68 L81 P83 D84 I86 I90 H109 P134	G23 F24 G25 S26 Q27 L46 S52 V66 L79 P81 D82 I84 I88 H107 P132

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004455 ketol-acid reductoisomerase activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0050661 NADP binding

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009099 L-valine biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:8upp, PDBe:8upp, PDBj:8upp
• PDBsum: 8upp
• UniProt: Q9PHN5|ILVC_CAMJE Ketol-acid reductoisomerase (NADP(+)) (Gene Name=ilvC)