Structure of PDB 8s8h Chain J

Receptor sequence

>8s8hJ (length=182) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

PRAPRTYSKTYSTPKRPYESARLDAELKLAGEYGLKNKREIYRISFQLSK
IRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKV
EDFLERRLQTQVYKLGLAKSVHHARVLISQRHIAVGKQIVNIPSFMVRLE
SEKHIDFARTSPFGGARPGRVARKRAAAAGGE

3D structure

PDB

8s8h Structural basis of AUC codon discrimination during translation initiation in yeast.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	P2 R3 P5 R6 T7 Y8 S9 K10 T11 T14 K16 R17 P18 Y19 L24 K37 N38 K39 R40 R44 R54 E72 R79 K120 S121 H124 R126 V127 Q131 R132 Q139 I140 V141 N142 I143 P144 F146 R149 S152 P163 R168 P169 G170 R171 V172 A173 R176	P1 R2 P4 R5 T6 Y7 S8 K9 T10 T13 K15 R16 P17 Y18 L23 K36 N37 K38 R39 R43 R53 E71 R78 K119 S120 H123 R125 V126 Q130 R131 Q138 I139 V140 N141 I142 P143 F145 R148 S151 P162 R167 P168 G169 R170 V171 A172 R175

External links

PDB	RCSB:8s8h, PDBe:8s8h, PDBj:8s8h
PDBsum	8s8h
PubMed	39193907
UniProt	Q6CM18

[Back to BioLiP]