Structure of PDB 8s54 Chain J |
>8s54J (length=67) Species: 9823 (Sus scrofa) [Search protein sequence] |
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL AHVDLIEKLLNYAPLEK |
|
PDB | 8s54 Three-step mechanism of promoter escape by RNA polymerase II |
Chain | J |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C7 C44 C45 |
C7 C44 C45 |
|
|
|
|