Structure of PDB 8s1p Chain J

Receptor sequence

>8s1pJ (length=143) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

TTPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTG
DHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKML
ELAIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELRG

3D structure

PDB

8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.

Chain

Resolution

1.96 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	T4 M6 N8 W16 T25 G27 R28 S31 R38 K40 H48 H54 T66 K68 K69 K73 Y76 R77 H78 T79 H81 P82 G83 L85 R88 K100 E103 A105 G108 M109 K112 S114 L115 R117 K121 H133 A135 Q136 K137 G145	T2 M4 N6 W14 T23 G25 R26 S29 R36 K38 H46 H52 T64 K66 K67 K71 Y74 R75 H76 T77 H79 P80 G81 L83 R86 K98 E101 A103 G106 M107 K110 S112 L113 R115 K119 H131 A133 Q134 K135 G143

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum	8s1p
PubMed	38811035
UniProt	P70974\|RL13_BACSU Large ribosomal subunit protein uL13 (Gene Name=rplM)