Structure of PDB 8qrm Chain J

Receptor sequence

>8qrmJ (length=108) Species: 9606 (Homo sapiens)

ATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKC
CRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKY
DCGHVQKK

3D structure

• PDB: 8qrm GTPBP8 plays a role in mitoribosome formation in human mitochondria.
• Chain: J
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	A31 T32 N34 Q35 R38 P41 P42 K43 R44 R47 K48 G54 R55 P56 Q57 K59 K71 K72 N74 S75 A76 N77 R78 R82 S86 P96 G97 E98 G112 Q116 D117 P119 K122 K129 H134 K137 K138	A1 T2 N4 Q5 R8 P11 P12 K13 R14 R17 K18 G24 R25 P26 Q27 K29 K41 K42 N44 S45 A46 N47 R48 R52 S56 P66 G67 E68 G82 Q86 D87 P89 K92 K99 H104 K107 K108

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qrm, PDBe:8qrm, PDBj:8qrm
• PDBsum: 8qrm
• PubMed: 38969660
• UniProt: O15235|RT12_HUMAN Small ribosomal subunit protein uS12m (Gene Name=MRPS12)