Structure of PDB 8qpe Chain J

Receptor sequence
>8qpeJ (length=224) Species: 9606 (Homo sapiens) [Search protein sequence]
LGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVL
GTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKE
DISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVE
GGPKAQKKFKRLMLHRIKNKCVLVWEGTAKDRSFGEMKFKQCPTENMARE
HFKKHGAEHYWDLALSESVLESTD
3D structure
PDB8qpe Structural insights into the cross-exon to cross-intron spliceosome switch
ChainJ
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J Q445 K447 R450 Q461 R507 Q508 H511 K526 Q10 K12 R15 Q26 R72 Q73 H76 K91
BS02 rna J K475 N480 R483 N515 R518 K519 L520 R525 K528 P554 F558 K559 R596 R601 K40 N45 R48 N80 R83 K84 L85 R90 K93 P119 F123 K124 R161 R166
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpe, PDBe:8qpe, PDBj:8qpe
PDBsum8qpe
PubMed38778104
UniProtO43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 (Gene Name=PRPF3)

[Back to BioLiP]