Structure of PDB 8qpb Chain J

Receptor sequence
>8qpbJ (length=84) Species: 9606 (Homo sapiens) [Search protein sequence]
LGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVL
GTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARK
3D structure
PDB8qpb Structural insights into the cross-exon to cross-intron spliceosome switch
ChainJ
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J Q445 K447 R450 R453 Q461 R465 H511 R518 Q10 K12 R15 R18 Q26 R30 H76 R83
BS02 rna J Q457 K475 R477 N480 V484 N515 R518 K519 Q22 K40 R42 N45 V49 N80 R83 K84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpb, PDBe:8qpb, PDBj:8qpb
PDBsum8qpb
PubMed38778104
UniProtO43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 (Gene Name=PRPF3)

[Back to BioLiP]