Structure of PDB 8q3b Chain J

Receptor sequence
>8q3bJ (length=80) Species: 10498 (African swine fever virus BA71V) [Search protein sequence]
MLIPVVCFTCGFPIGTYAAIFDKARTEYIKTKMDGTLPQNIPLDASLQIE
LKDLITALGIPMRVCCRTHLITTLDYRKYY
3D structure
PDB8q3b Structural characterization of the fully recombinant RNA polymerase from African Swine Fever Virus
ChainJ
Resolution2.69 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN J C7 C10 C65 C66 C7 C10 C65 C66
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0019083 viral transcription
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0030430 host cell cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q3b, PDBe:8q3b, PDBj:8q3b
PDBsum8q3b
PubMed38383525
UniProtP42488|RPB10_ASFB7 DNA-directed RNA polymerase RPB10 homolog (Gene Name=Ba71V-95)

[Back to BioLiP]