Structure of PDB 8peg Chain J

Receptor sequence
>8pegJ (length=100) Species: 562 (Escherichia coli) [Search protein sequence]
NQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVL
ISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL
3D structure
PDB8peg Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
ChainJ
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J R7 R9 H15 R37 G38 I40 P41 L42 P43 T44 R45 K46 T50 I53 S54 P55 H56 V57 N58 K59 R62 R68 H70 R72 R5 R7 H13 R35 G36 I38 P39 L40 P41 T42 R43 K44 T48 I51 S52 P53 H54 V55 N56 K57 R60 R66 H68 R70
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0001072 transcription antitermination factor activity, RNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0008023 transcription elongation factor complex
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8peg, PDBe:8peg, PDBj:8peg
PDBsum8peg
PubMed38409277
UniProtP0A7R5|RS10_ECOLI Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]