Structure of PDB 8pbc Chain J

Receptor sequence
>8pbcJ (length=311) Species: 9606 (Homo sapiens) [Search protein sequence]
GPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK
ADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPER
LLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLI
VDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVV
AQVDPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFA
INADGVGDAKD
3D structure
PDB8pbc Structural basis for stabilisation of the RAD51 nucleoprotein filament by BRCA2.
ChainJ
Resolution2.61 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0017116 single-stranded DNA helicase activity
GO:0019899 enzyme binding
GO:0042802 identical protein binding
GO:0070182 DNA polymerase binding
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000722 telomere maintenance via recombination
GO:0000724 double-strand break repair via homologous recombination
GO:0000730 DNA recombinase assembly
GO:0006259 DNA metabolic process
GO:0006268 DNA unwinding involved in DNA replication
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006312 mitotic recombination
GO:0006974 DNA damage response
GO:0007131 reciprocal meiotic recombination
GO:0010569 regulation of double-strand break repair via homologous recombination
GO:0010833 telomere maintenance via telomere lengthening
GO:0031297 replication fork processing
GO:0032200 telomere organization
GO:0036297 interstrand cross-link repair
GO:0042148 DNA strand invasion
GO:0051106 positive regulation of DNA ligation
GO:0051321 meiotic cell cycle
GO:0070192 chromosome organization involved in meiotic cell cycle
GO:0071312 cellular response to alkaloid
GO:0071479 cellular response to ionizing radiation
GO:0072711 cellular response to hydroxyurea
GO:0072757 cellular response to camptothecin
GO:1990414 replication-born double-strand break repair via sister chromatid exchange
GO:1990426 mitotic recombination-dependent replication fork processing
GO:1990918 double-strand break repair involved in meiotic recombination
GO:2000001 regulation of DNA damage checkpoint
Cellular Component
GO:0000152 nuclear ubiquitin ligase complex
GO:0000228 nuclear chromosome
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0000793 condensed chromosome
GO:0000794 condensed nuclear chromosome
GO:0000800 lateral element
GO:0001673 male germ cell nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0016605 PML body
GO:0032991 protein-containing complex
GO:0035861 site of double-strand break
GO:0048471 perinuclear region of cytoplasm
GO:0099182 presynaptic intermediate filament cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pbc, PDBe:8pbc, PDBj:8pbc
PDBsum8pbc
PubMed37919288
UniProtQ06609|RAD51_HUMAN DNA repair protein RAD51 homolog 1 (Gene Name=RAD51)

[Back to BioLiP]