Structure of PDB 8p2h Chain J

Receptor sequence

>8p2hJ (length=176) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

NRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLD
NAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLD
KLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRG
MDIVIVTTANTDEEARELLANFGMPF

3D structure

• PDB: 8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state
• Chain: J
• Resolution: 2.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K33 V35 N37 M38 G39 G41 T68 A70 K71 K72 I74 T76 F77 K88 A121 F122 D123 R125 N127 T129 G131 G151 M152 D153 V155	K32 V34 N36 M37 G38 G40 T67 A69 K70 K71 I73 T75 F76 K87 A120 F121 D122 R124 N126 T128 G130 G150 M151 D152 V154
BS02	rna	J	S24 M26 E27 Q63 K64 L66 T90 R92	S23 M25 E26 Q62 K63 L65 T89 R91

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p2h, PDBe:8p2h, PDBj:8p2h
• PDBsum: 8p2h
• PubMed: 38902339
• UniProt: Q2FW18|RL5_STAA8 Large ribosomal subunit protein uL5 (Gene Name=rplE)