Structure of PDB 8p2g Chain J

Receptor sequence

>8p2gJ (length=176) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

NRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLD
NAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLD
KLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRG
MDIVIVTTANTDEEARELLANFGMPF

3D structure

PDB

8p2g Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid

Chain

Resolution

2.02 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K33 V35 N37 M38 G39 G41 T68 A70 K71 K72 I74 T76 F77 I85 K88 A121 D123 R125 N127 T129 G131 G151 M152 D153 V155	K32 V34 N36 M37 G38 G40 T67 A69 K70 K71 I73 T75 F76 I84 K87 A120 D122 R124 N126 T128 G130 G150 M151 D152 V154
BS02	rna	J	S24 M26 E27 Q63 K64 L66 K69 T90 R92	S23 M25 E26 Q62 K63 L65 K68 T89 R91

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p2g, PDBe:8p2g, PDBj:8p2g
PDBsum	8p2g
PubMed	38902339
UniProt	Q2FW18\|RL5_STAA8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]