Structure of PDB 8ouf Chain J

Receptor sequence
>8oufJ (length=64) Species: 9606 (Homo sapiens) [Search protein sequence]
MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
RFKVLMTQQPRPVL
3D structure
PDB8ouf 2.7 angstrom cryo-EM structure of human telomerase H/ACA ribonucleoprotein.
ChainJ
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J R34 S36 R34 S36
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030515 snoRNA binding
GO:0034513 box H/ACA snoRNA binding
GO:0070034 telomerase RNA binding
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006364 rRNA processing
GO:0007004 telomere maintenance via telomerase
GO:0031118 rRNA pseudouridine synthesis
GO:0031120 snRNA pseudouridine synthesis
GO:0042254 ribosome biogenesis
GO:0090671 telomerase RNA localization to Cajal body
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0015030 Cajal body
GO:0016604 nuclear body
GO:0031429 box H/ACA snoRNP complex
GO:0072589 box H/ACA scaRNP complex
GO:0090661 box H/ACA telomerase RNP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ouf, PDBe:8ouf, PDBj:8ouf
PDBsum8ouf
PubMed38272871
UniProtQ9NPE3|NOP10_HUMAN H/ACA ribonucleoprotein complex subunit 3 (Gene Name=NOP10)

[Back to BioLiP]