Structure of PDB 8om4 Chain J

Receptor sequence
>8om4J (length=162) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
STRPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRT
GYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWD
TNPEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSTSAVGQKVLEL
LDSPDFKKHLEK
3D structure
PDB8om4 METTL17 is an Fe-S cluster checkpoint for mitochondrial translation.
ChainJ
Resolution2.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J K33 Y38 G39 T74 G75 P76 K77 P78 L79 P80 T81 R82 R83 R85 K90 S91 P92 F93 H95 K97 S98 H107 R109 L110 R112 K139 K18 Y23 G24 T59 G60 P61 K62 P63 L64 P65 T66 R67 R68 R70 K75 S76 P77 F78 H80 K82 S83 H92 R94 L95 R97 K124
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8om4, PDBe:8om4, PDBj:8om4
PDBsum8om4
PubMed38199006
UniProtQ03201|RT10_YEAST Small ribosomal subunit protein uS10m (Gene Name=RSM10)

[Back to BioLiP]