Structure of PDB 8kbc Chain J |
>8kbcJ (length=129) Species: 1392497 (Clostridioides mangenotii LM2) [Search protein sequence] |
GLVPRGSHMEIKNGLCTQKYTKVYAEDKEKWKFNAPHHFIVGKADCEDEY IEPIEYVNFQEGPIKEYGINGVNNEDLILMVITRLQAFQDSPYKCRENAM AITKLQECLMWLGKRTLDREVKGIEGTSE |
|
PDB | 8kbc Structure of CmTad1 complexed with cAAA |
Chain | J |
Resolution | 2.8 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
J |
R88 A91 T95 |
R96 A99 T103 |
|
|
|