Structure of PDB 8kab Chain J

Receptor sequence

>8kabJ (length=133) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

LIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVE
ITVYEDRSFTFALKTPPAAKLLLKAAGVQKGSGEPHKTKVAKVTWDQVRE
IAETKKADLNANDIDAAAKIIAGTARSMGITVE

3D structure

• PDB: 8kab Cryo-EM structures reveal the molecular mechanism of HflX-mediated erythromycin resistance in mycobacteria.
• Chain: J
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	L10 K12 L13 Q14 P24 P25 P28 A29 H33 K73 K89 G90 S91 G92 E93 P94 H95 K114 D117 L118 N119 A120 N121 D122 A125 K128 I129 G132 T133 R135 S136	L1 K3 L4 Q5 P15 P16 P19 A20 H24 K64 K80 G81 S82 G83 E84 P85 H86 K105 D108 L109 N110 A111 N112 D113 A116 K119 I120 G123 T124 R126 S127

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8kab, PDBe:8kab, PDBj:8kab
• PDBsum: 8kab
• PubMed: 39029461
• UniProt: A0QS45|RL11_MYCS2 Large ribosomal subunit protein uL11 (Gene Name=rplK)