Structure of PDB 8jww Chain J

Receptor sequence
>8jwwJ (length=32) Species: 1977402 (Inovirus M13) [Search protein sequence]
MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
3D structure
PDB8jww Cryo-EM structure of a bacteriophage M13 mini variant
ChainJ
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide J S7 S10 F11 G14 W15 R18 T22 R26 E29 S7 S10 F11 G14 W15 R18 T22 R26 E29
BS02 peptide J M1 V3 L4 F8 M1 V3 L4 F8
Gene Ontology
Cellular Component
GO:0016020 membrane
GO:0033644 host cell membrane
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:8jww, PDBe:8jww, PDBj:8jww
PDBsum8jww
PubMed
UniProtP69538|G9P_BPM13 Tail virion protein G9P (Gene Name=IX)

[Back to BioLiP]