Structure of PDB 8j6z Chain J

Receptor sequence
>8j6zJ (length=41) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
MRDLKTYLSVAPVLSTLWFGSLAGLLIEINRLFPDALTFPF
3D structure
PDB8j6z Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)
ChainJ
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J A11 P12 A11 P12
BS02 CLA J W18 F19 L22 L26 W18 F19 L22 L26
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j6z, PDBe:8j6z, PDBj:8j6z
PDBsum8j6z
PubMed37936349
UniProtP56769|PSAJ_ARATH Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]